Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) |
Family b.1.28.1: NEAT domain [158912] (4 proteins) Pfam PF05031; iron transport-associated domain |
Protein Iron-regulated surface determinant protein H, IsdH [158917] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [158918] (2 PDB entries) Uniprot Q6G8J7 86-229 |
Domain d4wjgx_: 4wjg X: [264124] Other proteins in same PDB: d4wjg1_, d4wjga_, d4wjgb_, d4wjgf_, d4wjgg_, d4wjgk_, d4wjgl_, d4wjgp_, d4wjgq_, d4wjgu_, d4wjgv_, d4wjgz_ automated match to d4wjg3_ complexed with hem, nag, oxy |
PDB Entry: 4wjg (more details), 3.1 Å
SCOPe Domain Sequences for d4wjgx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wjgx_ b.1.28.1 (X:) Iron-regulated surface determinant protein H, IsdH {Staphylococcus aureus [TaxId: 1280]} adeslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkae veldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqid dgeetnydytklvfakpiyndpsl
Timeline for d4wjgx_: