SCOPe 2.08: Domain d4whtt1: 4wht T:1-111

Lineage for d4whtt1 (4wht T:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)

8. Domain d4whtt1: 4wht T:1-111 [264105]
   Other proteins in same PDB: d4whtb2, d4whtd2, d4whtl2, d4whtn2, d4whtp2, d4whtr2, d4whtt2, d4whtv2, d4whty2
   automated match to d1c5da1

Details for d4whtt1

PDB Entry: 4wht, 2.22 Å

PDB Description: Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423 bound to the broadly neutralizing antibody 3/11, P1 crystal form

PDB Compounds: (T:) Light chain of the Fab fragment derived from neutralizing antibody 3/11

SCOPe Domain Sequences for d4whtt1:

Sequence; same for both SEQRES and ATOM records:

>d4whtt1 b.1.1.0 (T:1-111) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelk

Timeline for d4whtt1:

• d4whtt1 first appeared in SCOPe 2.05
  
• d4whtt1 appears in SCOPe 2.07