Lineage for d4wcud_ (4wcu D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014926Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2014986Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2014987Species Human (Homo sapiens) [TaxId:9606] [89152] (39 PDB entries)
    Uniprot Q08499 388-713
  8. 2015102Domain d4wcud_: 4wcu D: [264102]
    automated match to d3g58d_
    complexed with 3kq, mg, zn

Details for d4wcud_

PDB Entry: 4wcu (more details), 2.35 Å

PDB Description: PDE4 complexed with inhibitor
PDB Compounds: (D:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d4wcud_:

Sequence, based on SEQRES records: (download)

>d4wcud_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
dvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmtl
edhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvsn
qflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidivl
atdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplqly
rqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvh
pdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfel

Sequence, based on observed residues (ATOM records): (download)

>d4wcud_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
dvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmtl
edhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvsn
qflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidivl
atdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplqly
rqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvh
pdaqdildtlednrewyqstiptekfqfel

SCOPe Domain Coordinates for d4wcud_:

Click to download the PDB-style file with coordinates for d4wcud_.
(The format of our PDB-style files is described here.)

Timeline for d4wcud_: