![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Rhizobium meliloti [TaxId:266834] [260118] (3 PDB entries) |
![]() | Domain d4wbtc1: 4wbt C:2-371 [264099] Other proteins in same PDB: d4wbta2, d4wbtb2, d4wbtc2 automated match to d4wbtb_ complexed with gol, pe4, peg, pge, plp |
PDB Entry: 4wbt (more details), 1.6 Å
SCOPe Domain Sequences for d4wbtc1:
Sequence, based on SEQRES records: (download)
>d4wbtc1 c.67.1.0 (C:2-371) automated matches {Rhizobium meliloti [TaxId: 266834]} safsrftpliqslpasvpfvgpealerqhgrkiaariganesgfgpapsvllairqaagd twkyadpenhdlkqalarhlgtspaniaigegidgllgqivrlvveagapvvtslggypt fnyhvaghggrlvtvpyaddredlegllaavgrenaplvylanpdnpmgswwpaervvaf aqalpettllvldeaycetaprdalppieslidkpnvirartfskayglagarigytlst pgtaqafdkirnhfgmsrigvaaaiaaladqdylkevtlkiansrqrigriaadsglapl psatnfvavdcgkdasyaraivdrlmsdhgifirmpgvaplnrciristapdaemdllaa alpevirsla
>d4wbtc1 c.67.1.0 (C:2-371) automated matches {Rhizobium meliloti [TaxId: 266834]} safsrftpliqslfvgpealerqhgrkiaariganesgfgpapsvllairqaagdtwkya dpenhdlkqalarhlgtspaniaigegidgllgqivrlvveagapvvtslggyptfnyhv aghggrlvtvpyaddredlegllaavgrenaplvylanpdnpmgswwpaervvafaqalp ettllvldeaycetaprdalppieslidkpnvirartfskayglagarigytlstpgtaq afdkirnhfgmsrigvaaaiaaladqdylkevtlkiansrqrigriaadsglaplpsatn fvavdcgkdasyaraivdrlmsdhgifirmpgvaplnrciristapdaemdllaaalpev irsla
Timeline for d4wbtc1:
![]() Domains from other chains: (mouse over for more information) d4wbta1, d4wbta2, d4wbtb1, d4wbtb2 |