Lineage for d4wbta1 (4wbt A:2-371)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132865Species Rhizobium meliloti [TaxId:266834] [260118] (1 PDB entry)
  8. 2132866Domain d4wbta1: 4wbt A:2-371 [264098]
    Other proteins in same PDB: d4wbta2, d4wbtb2, d4wbtc2
    automated match to d4wbtb_
    complexed with gol, pe4, peg, pge, plp

Details for d4wbta1

PDB Entry: 4wbt (more details), 1.6 Å

PDB Description: crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
PDB Compounds: (A:) Probable histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d4wbta1:

Sequence, based on SEQRES records: (download)

>d4wbta1 c.67.1.0 (A:2-371) automated matches {Rhizobium meliloti [TaxId: 266834]}
safsrftpliqslpasvpfvgpealerqhgrkiaariganesgfgpapsvllairqaagd
twkyadpenhdlkqalarhlgtspaniaigegidgllgqivrlvveagapvvtslggypt
fnyhvaghggrlvtvpyaddredlegllaavgrenaplvylanpdnpmgswwpaervvaf
aqalpettllvldeaycetaprdalppieslidkpnvirartfskayglagarigytlst
pgtaqafdkirnhfgmsrigvaaaiaaladqdylkevtlkiansrqrigriaadsglapl
psatnfvavdcgkdasyaraivdrlmsdhgifirmpgvaplnrciristapdaemdllaa
alpevirsla

Sequence, based on observed residues (ATOM records): (download)

>d4wbta1 c.67.1.0 (A:2-371) automated matches {Rhizobium meliloti [TaxId: 266834]}
safsrftpliqslfvgpealerqhgrkiaariganesgfgpapsvllairqaagdtwkya
dpenhdlkqalarhlgtspaniaigegidgllgqivrlvveagapvvtslggyptfnyhv
aghggrlvtvpyaddredlegllaavgrenaplvylanpdnpmgswwpaervvafaqalp
ettllvldeaycetaprdalppieslidkpnvirartfskayglagarigytlstpgtaq
afdkirnhfgmsrigvaaaiaaladqdylkevtlkiansrqrigriaadsglaplpsatn
fvavdcgkdasyaraivdrlmsdhgifirmpgvaplnrciristapdaemdllaaalpev
irsla

SCOPe Domain Coordinates for d4wbta1:

Click to download the PDB-style file with coordinates for d4wbta1.
(The format of our PDB-style files is described here.)

Timeline for d4wbta1:

  • d4wbta1 first appeared in SCOPe 2.05, called d4wbta_