Lineage for d4wbsb_ (4wbs B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114011Species Burkholderia phymatum [TaxId:391038] [260120] (1 PDB entry)
  8. 2114013Domain d4wbsb_: 4wbs B: [264097]
    automated match to d4wbsa_
    complexed with cl

Details for d4wbsb_

PDB Entry: 4wbs (more details), 2 Å

PDB Description: crystal structure of an abc transporter related protein from burkholderia phymatum
PDB Compounds: (B:) ABC transporter related

SCOPe Domain Sequences for d4wbsb_:

Sequence, based on SEQRES records: (download)

>d4wbsb_ c.37.1.0 (B:) automated matches {Burkholderia phymatum [TaxId: 391038]}
sapalpnrkpagtssslvvrnlkkrygsrtvvkdvsldvksgevvgllgpngagkttsfy
mivglvpldageidldgksisllpihkraslglsylpqeasvfrklsveeniravlelqv
gddgkrlskdaiasrtealldelqishlrenpalslsggerrrveiaralatnpsfilld
epfagvdpiavleiqkivkflkqrnigvlitdhnvretlgicdhayiisdgsvlaagapg
diienesvrrvylgehfrm

Sequence, based on observed residues (ATOM records): (download)

>d4wbsb_ c.37.1.0 (B:) automated matches {Burkholderia phymatum [TaxId: 391038]}
sapalpnrkpagtssslvvrnlkkrygsrtvvkdvsldvksgevvgllgpngagkttsfy
mivglvpldageidldgksisllpihkraslglsylpqeasvfrklsveeniravlelqv
ggkrlskdaiasrtealldelqishlrenpalslsggerrrveiaralatnpsfilldep
fagvdpiavleiqkivkflkqrnigvlitdhnvretlgicdhayiisdgsvlaagapgdi
ienesvrrvylgehfrm

SCOPe Domain Coordinates for d4wbsb_:

Click to download the PDB-style file with coordinates for d4wbsb_.
(The format of our PDB-style files is described here.)

Timeline for d4wbsb_: