![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Brucella abortus [TaxId:359391] [259596] (1 PDB entry) |
![]() | Domain d4w9ub2: 4w9u B:242-394 [264096] Other proteins in same PDB: d4w9ua1, d4w9ub1, d4w9uc1, d4w9ud1 automated match to d4w9uc2 complexed with edo |
PDB Entry: 4w9u (more details), 2.4 Å
SCOPe Domain Sequences for d4w9ub2:
Sequence, based on SEQRES records: (download)
>d4w9ub2 a.29.3.0 (B:242-394) automated matches {Brucella abortus [TaxId: 359391]} lkgpfgclnrarygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmqte ialgiqaslrvgrlfdegkmapemisivkrnncgkaldiarqardmhggngiqieyhvmr haqnletvntyegthdvhalilgraqtgiqaff
>d4w9ub2 a.29.3.0 (B:242-394) automated matches {Brucella abortus [TaxId: 359391]} lkgpfgclnrarygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmqte ialgiqaslrvgrlfdegkmapemisivkrnncgkaldiarqardmhgeyhvmrhaqnle tvntyegthdvhalilgraqtgiqaff
Timeline for d4w9ub2: