Lineage for d4w9ub2 (4w9u B:242-394)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708509Species Brucella abortus [TaxId:359391] [259596] (1 PDB entry)
  8. 2708511Domain d4w9ub2: 4w9u B:242-394 [264096]
    Other proteins in same PDB: d4w9ua1, d4w9ub1, d4w9uc1, d4w9ud1
    automated match to d4w9uc2
    complexed with edo

Details for d4w9ub2

PDB Entry: 4w9u (more details), 2.4 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase from brucella melitensis
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4w9ub2:

Sequence, based on SEQRES records: (download)

>d4w9ub2 a.29.3.0 (B:242-394) automated matches {Brucella abortus [TaxId: 359391]}
lkgpfgclnrarygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmqte
ialgiqaslrvgrlfdegkmapemisivkrnncgkaldiarqardmhggngiqieyhvmr
haqnletvntyegthdvhalilgraqtgiqaff

Sequence, based on observed residues (ATOM records): (download)

>d4w9ub2 a.29.3.0 (B:242-394) automated matches {Brucella abortus [TaxId: 359391]}
lkgpfgclnrarygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmqte
ialgiqaslrvgrlfdegkmapemisivkrnncgkaldiarqardmhgeyhvmrhaqnle
tvntyegthdvhalilgraqtgiqaff

SCOPe Domain Coordinates for d4w9ub2:

Click to download the PDB-style file with coordinates for d4w9ub2.
(The format of our PDB-style files is described here.)

Timeline for d4w9ub2: