SCOPe 2.07: Domain d4w9ub2: 4w9u B:242-394

Lineage for d4w9ub2 (4w9u B:242-394)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (29 species)
   not a true protein

7. Species Brucella abortus [TaxId:359391] [259596] (1 PDB entry)

8. Domain d4w9ub2: 4w9u B:242-394 [264096]
   Other proteins in same PDB: d4w9ua1, d4w9ub1, d4w9uc1, d4w9ud1
   automated match to d4w9uc2
   complexed with edo

Details for d4w9ub2

PDB Entry: 4w9u, 2.4 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase from brucella melitensis

PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4w9ub2:

Sequence, based on SEQRES records:

>d4w9ub2 a.29.3.0 (B:242-394) automated matches {Brucella abortus [TaxId: 359391]}
lkgpfgclnrarygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmqte
ialgiqaslrvgrlfdegkmapemisivkrnncgkaldiarqardmhggngiqieyhvmr
haqnletvntyegthdvhalilgraqtgiqaff

Sequence, based on observed residues (ATOM records):

>d4w9ub2 a.29.3.0 (B:242-394) automated matches {Brucella abortus [TaxId: 359391]}
lkgpfgclnrarygiswgvlgaaedcwfrarqygldrkqfnkplagtqlyqkkladmqte
ialgiqaslrvgrlfdegkmapemisivkrnncgkaldiarqardmhgeyhvmrhaqnle
tvntyegthdvhalilgraqtgiqaff

Timeline for d4w9ub2:

• d4w9ub2 first appeared in SCOPe 2.05
  
• d4w9ub2 appears in SCOPe 2.06