SCOPe 2.06: Domain d4w9ua1: 4w9u A:3-241

Lineage for d4w9ua1 (4w9u A:3-241)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (25 species)
   not a true protein

7. Species Brucella abortus [TaxId:359391] [259594] (1 PDB entry)

8. Domain d4w9ua1: 4w9u A:3-241 [264093]
   Other proteins in same PDB: d4w9ua2, d4w9ub2, d4w9uc2, d4w9ud2
   automated match to d4w9uc1
   complexed with edo

Details for d4w9ua1

PDB Entry: 4w9u, 2.4 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase from brucella melitensis

PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4w9ua1:

Sequence, based on SEQRES records:

>d4w9ua1 e.6.1.0 (A:3-241) automated matches {Brucella abortus [TaxId: 359391]}
raafawedpflleeqltedermirdsakafasdvllprvekayleettdpelfhlmgqag
llgvtlpedygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeqrkk
ylpglvsgeligcfgltepdagsdpagmktraekidggyrlsgskmwisnspiadvfvvw
aksaahdnairgfilekgmkglsapkiggklslrasitgeivmdgvevsedailpnvsg

Sequence, based on observed residues (ATOM records):

>d4w9ua1 e.6.1.0 (A:3-241) automated matches {Brucella abortus [TaxId: 359391]}
raafawedpflleeqltedermirdsakafasdvllprvedpelfhlmgqagllgvtlpe
dygaanasyvayglvareveridsgyrsmmsvqsslvmypiyaygsdeqrkkylpglvsg
eligcfgltepmktraekidggyrlsgskmwisnspiadvfvvwaksaahdnairgfile
kgmkglsapkiasitgeivmdgvevsedailpnvsg

Timeline for d4w9ua1:

• d4w9ua1 first appeared in SCOPe 2.05
  
• d4w9ua1 appears in SCOPe 2.07
  
• d4w9ua1 appears in the current release, SCOPe 2.08