SCOP 1.69: Domain d1cu1b1: 1cu1 B:1705-1720,B:1003-1186

Lineage for d1cu1b1 (1cu1 B:1705-1720,B:1003-1186)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (2 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (11 PDB entries)

8. Domain d1cu1b1: 1cu1 B:1705-1720,B:1003-1186 [26409]
   Other proteins in same PDB: d1cu1a2, d1cu1a3, d1cu1b2, d1cu1b3

Details for d1cu1b1

PDB Entry: 1cu1, 2.5 Å

PDB Description: crystal structure of an enzyme complex from hepatitis c virus

SCOP Domain Sequences for d1cu1b1:

Sequence; same for both SEQRES and ATOM records:

>d1cu1b1 b.47.1.3 (B:1705-1720,B:1003-1186) NS3 protease {Human hepatitis C virus (HCV), different isolates}
gsvvivgriilsgsgsXitaysqqtrgllgciitsltgrdknqvegevqvvstatqsfla
tcvngvcwtvyhgagsktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdly
lvtrhadvipvrrrgdsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvak
avdfvpvesmettmrspvftd

Timeline for d1cu1b1:

• d1cu1b1 first appeared (with stable ids) in SCOP 1.55
  
• d1cu1b1 appears in SCOP 1.67
  
• d1cu1b1 appears in SCOP 1.71
  
• d1cu1b1 appears in the current release, SCOPe 2.08