![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Elongin B [54246] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
![]() | Domain d4w9ld_: 4w9l D: [264087] Other proteins in same PDB: d4w9lb_, d4w9lc_, d4w9le_, d4w9lf_, d4w9lh_, d4w9li_, d4w9lk1, d4w9lk2, d4w9ll_ automated match to d1lqba_ complexed with 3jj |
PDB Entry: 4w9l (more details), 2.2 Å
SCOPe Domain Sequences for d4w9ld_:
Sequence, based on SEQRES records: (download)
>d4w9ld_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
>d4w9ld_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafradtfealciepfssppelpdvm
Timeline for d4w9ld_: