Lineage for d1cu1a1 (1cu1 A:705-720,A:3-186)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 61083Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 61084Protein NS3 protease [50600] (2 species)
  7. 61089Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)
  8. 61098Domain d1cu1a1: 1cu1 A:705-720,A:3-186 [26408]
    Other proteins in same PDB: d1cu1a2, d1cu1a3, d1cu1b2, d1cu1b3

Details for d1cu1a1

PDB Entry: 1cu1 (more details), 2.5 Å

PDB Description: crystal structure of an enzyme complex from hepatitis c virus

SCOP Domain Sequences for d1cu1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cu1a1 b.47.1.3 (A:705-720,A:3-186) NS3 protease {Human hepatitis C virus (HCV), different isolates}
gsvvivgriilsgsgsXitaysqqtrgllgciitsltgrdknqvegevqvvstatqsfla
tcvngvcwtvyhgagsktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdly
lvtrhadvipvrrrgdsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvak
avdfvpvesmettmrspvftd

SCOP Domain Coordinates for d1cu1a1:

Click to download the PDB-style file with coordinates for d1cu1a1.
(The format of our PDB-style files is described here.)

Timeline for d1cu1a1: