![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Elongin B [54246] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
![]() | Domain d4w9kd_: 4w9k D: [264079] Other proteins in same PDB: d4w9kb_, d4w9kc_, d4w9ke_, d4w9kf_, d4w9kh_, d4w9ki_, d4w9kk1, d4w9kk2, d4w9kl_ automated match to d1lqba_ complexed with 3jo |
PDB Entry: 4w9k (more details), 2.1 Å
SCOPe Domain Sequences for d4w9kd_:
Sequence, based on SEQRES records: (download)
>d4w9kd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
>d4w9kd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafradtfealciepfssppelpdvm
Timeline for d4w9kd_: