Lineage for d4w9gb_ (4w9g B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189359Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2189360Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2189361Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2189438Protein Elongin C [54699] (3 species)
  7. 2189441Species Human (Homo sapiens) [TaxId:9606] [54700] (41 PDB entries)
  8. 2189552Domain d4w9gb_: 4w9g B: [264053]
    Other proteins in same PDB: d4w9ga_, d4w9gc_, d4w9gd_, d4w9gf_, d4w9gg_, d4w9gi_, d4w9gj_, d4w9gk2, d4w9gl_
    automated match to d4b9kb_
    complexed with 3jv

Details for d4w9gb_

PDB Entry: 4w9g (more details), 2.7 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(3-methyl-4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 6)
PDB Compounds: (B:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4w9gb_:

Sequence, based on SEQRES records: (download)

>d4w9gb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4w9gb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4w9gb_:

Click to download the PDB-style file with coordinates for d4w9gb_.
(The format of our PDB-style files is described here.)

Timeline for d4w9gb_: