SCOPe 2.08: Domain d4w9fj_: 4w9f J:

Lineage for d4w9fj_ (4w9f J:)

1. Root: SCOPe 2.08
2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)
5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240
6. Protein Elongin B [54246] (2 species)
7. Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries)
8. Domain d4w9fj_: 4w9f J: [264050]
   Other proteins in same PDB: d4w9fb1, d4w9fb2, d4w9fc_, d4w9fe_, d4w9ff_, d4w9fh_, d4w9fi_, d4w9fk1, d4w9fk2, d4w9fl_
   automated match to d1lqba_
   complexed with 3ju

Details for d4w9fj_

PDB Entry: 4w9f, 2.1 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 5)

PDB Compounds: (J:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4w9fj_:

Sequence; same for both SEQRES and ATOM records:

>d4w9fj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4w9fj_ are not available.

Timeline for d4w9fj_:

• d4w9fj_ first appeared in SCOPe 2.05
  
• d4w9fj_ appears in SCOPe 2.07