Lineage for d4w9fj_ (4w9f J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931238Domain d4w9fj_: 4w9f J: [264050]
    Other proteins in same PDB: d4w9fb1, d4w9fb2, d4w9fc_, d4w9fe_, d4w9ff_, d4w9fh_, d4w9fi_, d4w9fk1, d4w9fk2, d4w9fl_
    automated match to d1lqba_
    complexed with 3ju

Details for d4w9fj_

PDB Entry: 4w9f (more details), 2.1 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 5)
PDB Compounds: (J:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4w9fj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9fj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4w9fj_:

Click to download the PDB-style file with coordinates for d4w9fj_.
(The format of our PDB-style files is described here.)

Timeline for d4w9fj_: