![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Elongin B [54246] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
![]() | Domain d4w9fj_: 4w9f J: [264050] Other proteins in same PDB: d4w9fb1, d4w9fb2, d4w9fc_, d4w9fe_, d4w9ff_, d4w9fh_, d4w9fi_, d4w9fk1, d4w9fk2, d4w9fl_ automated match to d1lqba_ complexed with 3ju |
PDB Entry: 4w9f (more details), 2.1 Å
SCOPe Domain Sequences for d4w9fj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9fj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d4w9fj_: