| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Elongin B [54246] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
| Domain d4w9ej_: 4w9e J: [264042] Other proteins in same PDB: d4w9eb_, d4w9ec_, d4w9ee_, d4w9ef_, d4w9eh_, d4w9ei_, d4w9ek1, d4w9ek2, d4w9el_ automated match to d1lqba_ complexed with 3jt |
PDB Entry: 4w9e (more details), 2.6 Å
SCOPe Domain Sequences for d4w9ej_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9ej_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d4w9ej_: