Lineage for d4w9eh_ (4w9e H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903246Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1903304Protein Elongin C [54699] (3 species)
  7. 1903307Species Human (Homo sapiens) [TaxId:9606] [54700] (30 PDB entries)
  8. 1903382Domain d4w9eh_: 4w9e H: [264041]
    Other proteins in same PDB: d4w9ea_, d4w9ec_, d4w9ed_, d4w9ef_, d4w9eg_, d4w9ei_, d4w9ej_, d4w9el_
    automated match to d4b9kb_
    complexed with 3jt

Details for d4w9eh_

PDB Entry: 4w9e (more details), 2.6 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 4)
PDB Compounds: (H:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4w9eh_:

Sequence, based on SEQRES records: (download)

>d4w9eh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4w9eh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4w9eh_:

Click to download the PDB-style file with coordinates for d4w9eh_.
(The format of our PDB-style files is described here.)

Timeline for d4w9eh_: