Lineage for d4w9de_ (4w9d E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945540Protein Elongin C [54699] (3 species)
  7. 2945543Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)
  8. 2945576Domain d4w9de_: 4w9d E: [264031]
    Other proteins in same PDB: d4w9da_, d4w9dc_, d4w9dd_, d4w9df_, d4w9dg_, d4w9di_, d4w9dj_, d4w9dk2, d4w9dl_
    automated match to d4b9kb_
    complexed with 3jk

Details for d4w9de_

PDB Entry: 4w9d (more details), 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methyloxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 3)
PDB Compounds: (E:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4w9de_:

Sequence, based on SEQRES records: (download)

>d4w9de_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4w9de_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4w9de_:

Click to download the PDB-style file with coordinates for d4w9de_.
(The format of our PDB-style files is described here.)

Timeline for d4w9de_: