Lineage for d1jxp.1 (1jxp A:,C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 61083Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 61084Protein NS3 protease [50600] (2 species)
  7. 61089Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)
  8. 61092Domain d1jxp.1: 1jxp A:,C: [26402]

Details for d1jxp.1

PDB Entry: 1jxp (more details), 2.2 Å

PDB Description: bk strain hepatitis c virus (hcv) ns3-ns4a

SCOP Domain Sequences for d1jxp.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1jxp.1 b.47.1.3 (A:,C:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmXgs
vvivgriils

SCOP Domain Coordinates for d1jxp.1:

Click to download the PDB-style file with coordinates for d1jxp.1.
(The format of our PDB-style files is described here.)

Timeline for d1jxp.1: