Lineage for d4w91e_ (4w91 E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2148536Species Brucella suis [TaxId:520488] [260277] (1 PDB entry)
  8. 2148541Domain d4w91e_: 4w91 E: [264015]
    automated match to d4w91b_
    complexed with cl

Details for d4w91e_

PDB Entry: 4w91 (more details), 2.45 Å

PDB Description: Crystal structure of a cysteine desulfurase SufS from Brucella suis bound to PLP
PDB Compounds: (E:) aminotransferase

SCOPe Domain Sequences for d4w91e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w91e_ c.67.1.0 (E:) automated matches {Brucella suis [TaxId: 520488]}
ydveairrdfpilsrqvhgktlvyldngasaqkpqsvidavthayaneyanvhrglhfls
naatdayeksretvrrflnagsvdeivftknateaintvaygygmpfigegdeillsime
hhsnivpwhfirerqgaklvftpvddngvfhieefekrlsertklvaithmsntlgtvvp
ikkivelahargipvlvdgsqgavhlpvdvqdlgcdwyvftghkvygpsgigvlygraqm
lekmrpfqgggemieevteenvtynhpphrfeagtppivqaiglgaaleymekigrhail
aheadlrdyaherlgrinslrifgnapdkgaiisfalegihahdvsmvidragvavragt
hcaqpllkrfgvtstcrasfalyntraevdalaealekarkffg

SCOPe Domain Coordinates for d4w91e_:

Click to download the PDB-style file with coordinates for d4w91e_.
(The format of our PDB-style files is described here.)

Timeline for d4w91e_: