Lineage for d4uygf_ (4uyg F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (11 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (724 PDB entries)
  8. 2317762Domain d4uygf_: 4uyg F: [264011]
    automated match to d4a9ib_
    complexed with 73b, so4

Details for d4uygf_

PDB Entry: 4uyg (more details), 2.5 Å

PDB Description: C-Terminal bromodomain of Human BRD2 with I-BET726 (GSK1324726A)
PDB Compounds: (F:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d4uygf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uygf_ a.29.2.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

SCOPe Domain Coordinates for d4uygf_:

Click to download the PDB-style file with coordinates for d4uygf_.
(The format of our PDB-style files is described here.)

Timeline for d4uygf_: