Lineage for d4uy2a_ (4uy2 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2074176Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2074177Protein automated matches [193506] (6 species)
    not a true protein
  7. 2074530Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries)
  8. 2074558Domain d4uy2a_: 4uy2 A: [264006]
    Other proteins in same PDB: d4uy2c_, d4uy2d_
    automated match to d4d01a_
    complexed with nag

Details for d4uy2a_

PDB Entry: 4uy2 (more details), 2.7 Å

PDB Description: Crystal structure of the complex of the extracellular domain of human alpha9 nAChR with alpha-bungarotoxin.
PDB Compounds: (A:) neuronal acetylcholine receptor subunit alpha-9

SCOPe Domain Sequences for d4uy2a_:

Sequence, based on SEQRES records: (download)

>d4uy2a_ b.96.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqiwhd
ayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitwdapa
itksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhgmp
avknvisygccsepypdvtftlllkrrs

Sequence, based on observed residues (ATOM records): (download)

>d4uy2a_ b.96.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqiwhd
ayltwdrdqydgldsiripsdlvwrpdivlynkadpvntnvvlrydglitwdapaitkss
cvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhgmpavknv
isygccsepypdvtftlllkrrs

SCOPe Domain Coordinates for d4uy2a_:

Click to download the PDB-style file with coordinates for d4uy2a_.
(The format of our PDB-style files is described here.)

Timeline for d4uy2a_: