SCOPe 2.06: Domain d4urnc_: 4urn C:

Lineage for d4urnc_ (4urn C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (14 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (19 PDB entries)

8. Domain d4urnc_: 4urn C: [264003]
   automated match to d4hymb1
   complexed with nov

Details for d4urnc_

PDB Entry: 4urn, 2.3 Å

PDB Description: Crystal Structure of Staph ParE 24kDa in complex with Novobiocin

PDB Compounds: (C:) DNA topoisomerase IV, B subunit

SCOPe Domain Sequences for d4urnc_:

Sequence, based on SEQRES records:

>d4urnc_ d.122.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gleavrkrpgmyigstdkrglhhlvyeivdnsvdevlngygneidvtinkdgsisiedng
rgmptgihksgkptveviftvlhaggkfgqggyktsgglhgvgasvvnalsewleveihr
dgniyhqsfknggspssglvkkgktkktgtkvtfkpddtifkastsfnfdvlserlqesa
fllknlkitlndlrsgkerqehyhye

Sequence, based on observed residues (ATOM records):

>d4urnc_ d.122.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gleavrkrpgmyigstdkrglhhlvyeivdnsvdevlngygneidvtinkdgsisiedng
rgmptgihksgkptveviftvlgasvvnalsewleveihrdgniyhqsfknggspssglv
kkgktkktgtkvtfkpddtifkastsfnfdvlserlqesafllknlkitlndlrsgkerq
ehyhye

Timeline for d4urnc_:

• d4urnc_ first appeared in SCOPe 2.05
  
• d4urnc_ appears in SCOPe 2.07
  
• d4urnc_ appears in the current release, SCOPe 2.08