SCOPe 2.08: Domain d4urmb_: 4urm B:

Lineage for d4urmb_ (4urm B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (22 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries)

8. Domain d4urmb_: 4urm B: [264000]
   automated match to d4k4oa_
   complexed with xam

Details for d4urmb_

PDB Entry: 4urm, 2.94 Å

PDB Description: Crystal Structure of Staph GyraseB 24kDa in complex with Kibdelomycin

PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d4urmb_:

Sequence, based on SEQRES records:

>d4urmb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr
gipvdiqekmgrpaveviltvlhaggkfggggykvsgglhgvgssvvnalsqdlevyvhr
netiyhqaykkgvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaf
lnkgiqitlrderdeenvredsyhyeg

Sequence, based on observed residues (ATOM records):

>d4urmb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr
gipvdiqekmgrpaveviltvlhaggkfgvgssvvnalsqdlevyvhrnetiyhqaykkg
vpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrde
rdeenvredsyhyeg

Timeline for d4urmb_:

• d4urmb_ first appeared in SCOPe 2.05
  
• d4urmb_ appears in SCOPe 2.07