Lineage for d4urmb_ (4urm B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974158Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries)
  8. 2974204Domain d4urmb_: 4urm B: [264000]
    automated match to d4k4oa_
    complexed with xam

Details for d4urmb_

PDB Entry: 4urm (more details), 2.94 Å

PDB Description: Crystal Structure of Staph GyraseB 24kDa in complex with Kibdelomycin
PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d4urmb_:

Sequence, based on SEQRES records: (download)

>d4urmb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr
gipvdiqekmgrpaveviltvlhaggkfggggykvsgglhgvgssvvnalsqdlevyvhr
netiyhqaykkgvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaf
lnkgiqitlrderdeenvredsyhyeg

Sequence, based on observed residues (ATOM records): (download)

>d4urmb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr
gipvdiqekmgrpaveviltvlhaggkfgvgssvvnalsqdlevyvhrnetiyhqaykkg
vpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrde
rdeenvredsyhyeg

SCOPe Domain Coordinates for d4urmb_:

Click to download the PDB-style file with coordinates for d4urmb_.
(The format of our PDB-style files is described here.)

Timeline for d4urmb_: