| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) ![]() |
| Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
| Protein automated matches [190110] (7 species) not a true protein |
| Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries) |
| Domain d4upvb_: 4upv B: [263994] Other proteins in same PDB: d4upvq_, d4upvr_ automated match to d1ubks_ complexed with cl, f3s, fco, gly, gol, h2s, mg, ni, sf4, sot; mutant |
PDB Entry: 4upv (more details), 1.52 Å
SCOPe Domain Sequences for d4upvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4upvb_ e.19.1.1 (B:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
takhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalh
qalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvq
kakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfyge
lvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqa
ghpclgcsepdfwdtmtpfyeqg
Timeline for d4upvb_: