Lineage for d4upvb_ (4upv B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019034Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 3019069Protein automated matches [190110] (7 species)
    not a true protein
  7. 3019109Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)
  8. 3019118Domain d4upvb_: 4upv B: [263994]
    Other proteins in same PDB: d4upvq_, d4upvr_
    automated match to d1ubks_
    complexed with cl, f3s, fco, gly, gol, h2s, mg, ni, sf4, sot; mutant

Details for d4upvb_

PDB Entry: 4upv (more details), 1.52 Å

PDB Description: low x-ray dose structure of a ni-a ni-sox mixture of the d. fructosovorans nife-hydrogenase l122a mutant
PDB Compounds: (B:) nife-hydrogenase small subunit

SCOPe Domain Sequences for d4upvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4upvb_ e.19.1.1 (B:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
takhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalh
qalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvq
kakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfyge
lvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqa
ghpclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d4upvb_:

Click to download the PDB-style file with coordinates for d4upvb_.
(The format of our PDB-style files is described here.)

Timeline for d4upvb_: