Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258556] (3 PDB entries) |
Domain d4uo3f_: 4uo3 F: [263984] Other proteins in same PDB: d4uo3a_, d4uo3c_, d4uo3e_ automated match to d4uo1b_ complexed with edo, nag; mutant |
PDB Entry: 4uo3 (more details), 2.87 Å
SCOPe Domain Sequences for d4uo3f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo3f_ h.3.1.1 (F:) automated matches {Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]} gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqtaidqineklnrviertn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrf
Timeline for d4uo3f_: