Lineage for d4uo3d_ (4uo3 D:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1969971Species Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258556] (3 PDB entries)
  8. 1969976Domain d4uo3d_: 4uo3 D: [263982]
    Other proteins in same PDB: d4uo3a_, d4uo3c_, d4uo3e_
    automated match to d4uo1b_
    complexed with edo, nag; mutant

Details for d4uo3d_

PDB Entry: 4uo3 (more details), 2.87 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin mutant ser30thr
PDB Compounds: (D:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4uo3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo3d_ h.3.1.1 (D:) automated matches {Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqtaidqineklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4uo3d_:

Click to download the PDB-style file with coordinates for d4uo3d_.
(The format of our PDB-style files is described here.)

Timeline for d4uo3d_: