SCOPe 2.07: Domain d1vcqa_: 1vcq A:

Lineage for d1vcqa_ (1vcq A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Semliki forest virus [TaxId:11033] [50599] (2 PDB entries)

8. Domain d1vcqa_: 1vcq A: [26398]

Details for d1vcqa_

PDB Entry: 1vcq, 3.1 Å

PDB Description: semliki forest virus capsid protein (crystal form ii)

PDB Compounds: (A:) semliki forest virus capsid protein

SCOPe Domain Sequences for d1vcqa_:

Sequence; same for both SEQRES and ATOM records:

>d1vcqa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

Timeline for d1vcqa_:

• d1vcqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1vcqa_ appears in SCOPe 2.06
  
• d1vcqa_ appears in the current release, SCOPe 2.08