Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258552] (2 PDB entries) |
Domain d4unzd_: 4unz D: [263978] Other proteins in same PDB: d4unza_, d4unzc1, d4unzc2, d4unze_ automated match to d4unzb_ complexed with nag |
PDB Entry: 4unz (more details), 2.9 Å
SCOPe Domain Sequences for d4unzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4unzd_ h.3.1.1 (D:) automated matches {Influenza A virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]} gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq
Timeline for d4unzd_: