Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258552] (2 PDB entries) |
Domain d4unwf_: 4unw F: [263976] Other proteins in same PDB: d4unwa_, d4unwc_, d4unwe_ automated match to d4unzb_ complexed with nag |
PDB Entry: 4unw (more details), 2.6 Å
SCOPe Domain Sequences for d4unwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4unwf_ h.3.1.1 (F:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]} gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq
Timeline for d4unwf_: