Class b: All beta proteins [48724] (177 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (25 species) not a true protein |
Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258548] (2 PDB entries) |
Domain d4unwc_: 4unw C: [263974] Other proteins in same PDB: d4unwb_, d4unwd_, d4unwf_ automated match to d4unzc_ complexed with nag |
PDB Entry: 4unw (more details), 2.6 Å
SCOPe Domain Sequences for d4unwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4unwc_ b.19.1.2 (C:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]} nntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvldgrnctli damlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtleftaegftw tgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyiwgihhpss nkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkpgdilmins ngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnkitygkcpk yirqntlklatgmrnvpekqi
Timeline for d4unwc_: