Lineage for d4unwb_ (4unw B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1969964Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258552] (2 PDB entries)
  8. 1969965Domain d4unwb_: 4unw B: [263973]
    Other proteins in same PDB: d4unwa_, d4unwc_, d4unwe_
    automated match to d4unzb_
    complexed with nag

Details for d4unwb_

PDB Entry: 4unw (more details), 2.6 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin
PDB Compounds: (B:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4unwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4unwb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4unwb_:

Click to download the PDB-style file with coordinates for d4unwb_.
(The format of our PDB-style files is described here.)

Timeline for d4unwb_: