Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein Viral capsid protein [50597] (3 species) |
Species Semliki forest virus [TaxId:11033] [50599] (2 PDB entries) |
Domain d1vcpc_: 1vcp C: [26397] complexed with hg |
PDB Entry: 1vcp (more details), 3 Å
SCOPe Domain Sequences for d1vcpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcpc_ b.47.1.3 (C:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga negsrtalsvvtwnkdmvtrvtpegseew
Timeline for d1vcpc_: