| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein automated matches [227027] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries) |
| Domain d4un0a1: 4un0 A:22-157 [263963] Other proteins in same PDB: d4un0c_, d4un0d_ automated match to d2i53a1 |
PDB Entry: 4un0 (more details), 3.15 Å
SCOPe Domain Sequences for d4un0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4un0a1 a.74.1.1 (A:22-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhrf
ymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeevm
vlerillqtikfdlqv
Timeline for d4un0a1:
View in 3DDomains from other chains: (mouse over for more information) d4un0b1, d4un0b2, d4un0c_, d4un0d_ |