Lineage for d4umyb_ (4umy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138634Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 protein domains)
    the active site is between the two identical subunits
  6. 2138768Protein automated matches [190072] (19 species)
    not a true protein
  7. 2138837Species Human (Homo sapiens) [TaxId:9606] [189131] (7 PDB entries)
  8. 2138843Domain d4umyb_: 4umy B: [263962]
    automated match to d4l03c_
    complexed with gol, nap, so4

Details for d4umyb_

PDB Entry: 4umy (more details), 2.07 Å

PDB Description: idh1 r132h in complex with cpd 1
PDB Compounds: (B:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d4umyb_:

Sequence, based on SEQRES records: (download)

>d4umyb_ c.77.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
gwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqak

Sequence, based on observed residues (ATOM records): (download)

>d4umyb_ c.77.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
gwvkpiiighharatdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgmynqdk
siedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqywyehrliddmva
qamkseggfiwacknslgmmtsvlvcpdgktveaeaahgtvtrhyrmyqkgqetstnpia
sifawtrglahrakldnnkelaffanaleevsietieagfmtkdlaacikglpnvqrsdy
lntfefmdklgenlkiklaqak

SCOPe Domain Coordinates for d4umyb_:

Click to download the PDB-style file with coordinates for d4umyb_.
(The format of our PDB-style files is described here.)

Timeline for d4umyb_: