Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) automatically mapped to Pfam PF01788 |
Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
Protein automated matches [191002] (2 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (3 PDB entries) |
Domain d4ub8j_: 4ub8 J: [263959] Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8f_, d4ub8h_, d4ub8i_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_ automated match to d4ub6j_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 4ub8 (more details), 1.95 Å
SCOPe Domain Sequences for d4ub8j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ub8j_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} seggriplwivatvagmgvivivglffygayaglgssl
Timeline for d4ub8j_: