Lineage for d4ub8j_ (4ub8 J:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958458Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) (S)
    automatically mapped to Pfam PF01788
  5. 1958459Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 1958467Protein automated matches [191002] (2 species)
    not a true protein
  7. 1958471Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (3 PDB entries)
  8. 1958473Domain d4ub8j_: 4ub8 J: [263959]
    Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8f_, d4ub8h_, d4ub8i_, d4ub8k_, d4ub8l_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_
    automated match to d4ub6j_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub8j_

PDB Entry: 4ub8 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-2) by a femtosecond x-ray laser
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d4ub8j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub8j_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
seggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d4ub8j_:

Click to download the PDB-style file with coordinates for d4ub8j_.
(The format of our PDB-style files is described here.)

Timeline for d4ub8j_: