SCOPe 2.06: Domain d4twgf_: 4twg F:

Lineage for d4twgf_ (4twg F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.0: automated matches [191349] (1 protein)
   not a true family

6. Protein automated matches [190284] (9 species)
   not a true protein

7. Species Mycobacterium ulcerans [TaxId:362242] [260972] (1 PDB entry)

8. Domain d4twgf_: 4twg F: [263946]
   automated match to d4twgd_
   complexed with cit, edo

Details for d4twgf_

PDB Entry: 4twg, 1.85 Å

PDB Description: the structure of the molybdopterin biosynthesis mog protein from mycobacterium ulcerans

PDB Compounds: (F:) molybdopterin biosynthesis Mog protein

SCOPe Domain Sequences for d4twgf_:

Sequence, based on SEQRES records:

>d4twgf_ c.57.1.0 (F:) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
starsaqiiiastraasgvytdecgpiiaewleqrgfspleskvvadgnpvgealqdave
aqvdliitsggtgisptdstpeqtvavldfvipgladairraglpkvptsvlsrgvcgva
gqtlivnlpgspggvrdgldvladvvhhaldqiagq

Sequence, based on observed residues (ATOM records):

>d4twgf_ c.57.1.0 (F:) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
starsaqiiiastraastdecgpiiaewleqrgfspleskvvadgnpvgealqdaveaqv
dliitsggtgisptdstpeqtvavldfvipgladairraglpkvptsvlsrgvcgvagqt
livnlpgspggvrdgldvladvvhhaldqiagq

Timeline for d4twgf_:

• d4twgf_ first appeared in SCOPe 2.05
  
• d4twgf_ appears in SCOPe 2.07
  
• d4twgf_ appears in the current release, SCOPe 2.08