Lineage for d4twgb_ (4twg B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890232Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 2890233Protein automated matches [190284] (9 species)
    not a true protein
  7. 2890241Species Mycobacterium ulcerans [TaxId:362242] [260972] (1 PDB entry)
  8. 2890243Domain d4twgb_: 4twg B: [263943]
    automated match to d4twgd_
    complexed with cit, edo

Details for d4twgb_

PDB Entry: 4twg (more details), 1.85 Å

PDB Description: the structure of the molybdopterin biosynthesis mog protein from mycobacterium ulcerans
PDB Compounds: (B:) molybdopterin biosynthesis Mog protein

SCOPe Domain Sequences for d4twgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4twgb_ c.57.1.0 (B:) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
arsaqiiiastraasgvytdecgpiiaewleqrgfspleskvvadgnpvgealqdaveaq
vdliitsggtgisptdstpeqtvavldfvipgladairraglpkvptsvlsrgvcgvagq
tlivnlpgspggvrdgldvladvvhhaldqiag

SCOPe Domain Coordinates for d4twgb_:

Click to download the PDB-style file with coordinates for d4twgb_.
(The format of our PDB-style files is described here.)

Timeline for d4twgb_: