![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.0: automated matches [191349] (1 protein) not a true family |
![]() | Protein automated matches [190284] (9 species) not a true protein |
![]() | Species Mycobacterium ulcerans [TaxId:362242] [260972] (1 PDB entry) |
![]() | Domain d4twgb_: 4twg B: [263943] automated match to d4twgd_ complexed with cit, edo |
PDB Entry: 4twg (more details), 1.85 Å
SCOPe Domain Sequences for d4twgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4twgb_ c.57.1.0 (B:) automated matches {Mycobacterium ulcerans [TaxId: 362242]} arsaqiiiastraasgvytdecgpiiaewleqrgfspleskvvadgnpvgealqdaveaq vdliitsggtgisptdstpeqtvavldfvipgladairraglpkvptsvlsrgvcgvagq tlivnlpgspggvrdgldvladvvhhaldqiag
Timeline for d4twgb_: