Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (16 PDB entries) |
Domain d4tv9b2: 4tv9 B:246-438 [263938] Other proteins in same PDB: d4tv9a1, d4tv9b1, d4tv9c1, d4tv9d1, d4tv9e_ automated match to d3rycd2 complexed with 3h4, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4tv9 (more details), 2 Å
SCOPe Domain Sequences for d4tv9b2:
Sequence, based on SEQRES records: (download)
>d4tv9b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
>d4tv9b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltqyraltvpeltqqmfdsknmmaacdprhg ryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfi gnstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda
Timeline for d4tv9b2: