Lineage for d4tv8c2 (4tv8 C:246-440)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914315Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1914316Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1914423Protein automated matches [227071] (5 species)
    not a true protein
  7. 1914424Species Cow (Bos taurus) [TaxId:9913] [226565] (16 PDB entries)
  8. 1914451Domain d4tv8c2: 4tv8 C:246-440 [263934]
    Other proteins in same PDB: d4tv8a1, d4tv8b1, d4tv8c1, d4tv8d1, d4tv8e_
    automated match to d4i50a2
    complexed with 3gt, acp, ca, gdp, gol, gtp, mes, mg

Details for d4tv8c2

PDB Entry: 4tv8 (more details), 2.1 Å

PDB Description: Tubulin-Maytansine complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4tv8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tv8c2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d4tv8c2:

Click to download the PDB-style file with coordinates for d4tv8c2.
(The format of our PDB-style files is described here.)

Timeline for d4tv8c2: