Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries) |
Domain d4tv8b2: 4tv8 B:246-438 [263932] Other proteins in same PDB: d4tv8a1, d4tv8b1, d4tv8c1, d4tv8d1, d4tv8e_, d4tv8f1, d4tv8f2, d4tv8f3 automated match to d3rycd2 complexed with 3gt, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4tv8 (more details), 2.1 Å
SCOPe Domain Sequences for d4tv8b2:
Sequence, based on SEQRES records: (download)
>d4tv8b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
>d4tv8b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrsqqyraltvpeltqqmfdsknmmaacd prhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkms atfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqq yqda
Timeline for d4tv8b2: