SCOPe 2.05: Domain d4tv8b2: 4tv8 B:246-438

Lineage for d4tv8b2 (4tv8 B:246-438)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (16 PDB entries)

8. Domain d4tv8b2: 4tv8 B:246-438 [263932]
   Other proteins in same PDB: d4tv8a1, d4tv8b1, d4tv8c1, d4tv8d1, d4tv8e_
   automated match to d3rycd2
   complexed with 3gt, acp, ca, gdp, gol, gtp, mes, mg

Details for d4tv8b2

PDB Entry: 4tv8, 2.1 Å

PDB Description: Tubulin-Maytansine complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4tv8b2:

Sequence, based on SEQRES records:

>d4tv8b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records):

>d4tv8b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrsqqyraltvpeltqqmfdsknmmaacd
prhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkms
atfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqq
yqda

Timeline for d4tv8b2:

• d4tv8b2 is new in SCOPe 2.05-stable
  
• d4tv8b2 appears in SCOPe 2.06
  
• d4tv8b2 appears in the current release, SCOPe 2.08