Lineage for d4tv8b2 (4tv8 B:246-438)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959219Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
  8. 2959272Domain d4tv8b2: 4tv8 B:246-438 [263932]
    Other proteins in same PDB: d4tv8a1, d4tv8b1, d4tv8c1, d4tv8d1, d4tv8e_, d4tv8f1, d4tv8f2, d4tv8f3
    automated match to d3rycd2
    complexed with 3gt, acp, ca, gdp, gol, gtp, mes, mg

Details for d4tv8b2

PDB Entry: 4tv8 (more details), 2.1 Å

PDB Description: Tubulin-Maytansine complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4tv8b2:

Sequence, based on SEQRES records: (download)

>d4tv8b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d4tv8b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrsqqyraltvpeltqqmfdsknmmaacd
prhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkms
atfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqq
yqda

SCOPe Domain Coordinates for d4tv8b2:

Click to download the PDB-style file with coordinates for d4tv8b2.
(The format of our PDB-style files is described here.)

Timeline for d4tv8b2: