SCOPe 2.06: Domain d4tuhg1: 4tuh G:1-196

Lineage for d4tuhg1 (4tuh G:1-196)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (35 PDB entries)

8. Domain d4tuhg1: 4tuh G:1-196 [263923]
   Other proteins in same PDB: d4tuha2, d4tuhb2, d4tuhc2, d4tuhf2, d4tuhg2, d4tuhh2
   automated match to d2o1ya_
   complexed with 38h, act, edo

Details for d4tuhg1

PDB Entry: 4tuh, 1.8 Å

PDB Description: bcl-xl in complex with inhibitor (compound 10)

PDB Compounds: (G:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4tuhg1:

Sequence; same for both SEQRES and ATOM records:

>d4tuhg1 f.1.4.1 (G:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelyg

Timeline for d4tuhg1:

• d4tuhg1 first appeared in SCOPe 2.05, called d4tuhg_
  
• d4tuhg1 appears in SCOPe 2.07
  
• d4tuhg1 appears in the current release, SCOPe 2.08