Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein Apoptosis regulator Bcl-xL [56856] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56857] (35 PDB entries) |
Domain d4tuhb1: 4tuh B:1-196 [263918] Other proteins in same PDB: d4tuha2, d4tuhb2, d4tuhc2, d4tuhf2, d4tuhg2, d4tuhh2 automated match to d2o1ya_ complexed with 38h, act, edo |
PDB Entry: 4tuh (more details), 1.8 Å
SCOPe Domain Sequences for d4tuhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tuhb1 f.1.4.1 (B:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]} msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd hlepwiqenggwdtfvelyg
Timeline for d4tuhb1: