Lineage for d4tu1d1 (4tu1 D:23-355)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085157Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2085665Protein automated matches [190095] (24 species)
    not a true protein
  7. 2085959Species Toxoplasma gondii [TaxId:5811] [259539] (2 PDB entries)
  8. 2085964Domain d4tu1d1: 4tu1 D:23-355 [263917]
    Other proteins in same PDB: d4tu1a2, d4tu1b2, d4tu1c2, d4tu1d2
    automated match to d4tu1a_
    complexed with gol

Details for d4tu1d1

PDB Entry: 4tu1 (more details), 2 Å

PDB Description: structure of toxoplasma gondii fructose 1,6 bisphosphate aldolase
PDB Compounds: (D:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d4tu1d1:

Sequence, based on SEQRES records: (download)

>d4tu1d1 c.1.10.1 (D:23-355) automated matches {Toxoplasma gondii [TaxId: 5811]}
isqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyrdllfstk
glgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltddekatmgl
dglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicqanrlvpi
vepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsdcpkpash
eeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsfsygralq
asclkawkgvpenkakaqqvlmerarangeaql

Sequence, based on observed residues (ATOM records): (download)

>d4tu1d1 c.1.10.1 (D:23-355) automated matches {Toxoplasma gondii [TaxId: 5811]}
isqevakelaenarkiaapgkgilaadestgtikkrfdsigvenfyrdllfstkglgqyi
sgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltddekatmgldglser
ckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicqanrlvpivepeil
tdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsdcpkpasheeiafy
tvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsfsygralqasclka
wkgvpenkakaqqvlmerarangeaql

SCOPe Domain Coordinates for d4tu1d1:

Click to download the PDB-style file with coordinates for d4tu1d1.
(The format of our PDB-style files is described here.)

Timeline for d4tu1d1:

  • d4tu1d1 first appeared in SCOPe 2.05, called d4tu1d_