| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) ![]() consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
| Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
| Protein automated matches [190583] (3 species) not a true protein |
| Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries) |
| Domain d4tqoo_: 4tqo O: [263916] Other proteins in same PDB: d4tqoa_, d4tqob_, d4tqoc_, d4tqod_, d4tqoe_, d4tqof_, d4tqog_, d4tqoh_ automated match to d4tqop_ complexed with ca, pqq |
PDB Entry: 4tqo (more details), 2.57 Å
SCOPe Domain Sequences for d4tqoo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tqoo_ a.137.2.1 (O:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedik
Timeline for d4tqoo_: