Lineage for d4tqon_ (4tqo N:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733707Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 2733708Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 2733735Protein automated matches [190583] (3 species)
    not a true protein
  7. 2733740Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries)
  8. 2733778Domain d4tqon_: 4tqo N: [263915]
    Other proteins in same PDB: d4tqoa_, d4tqob_, d4tqoc_, d4tqod_, d4tqoe_, d4tqof_, d4tqog_, d4tqoh_
    automated match to d4tqop_
    complexed with ca, pqq

Details for d4tqon_

PDB Entry: 4tqo (more details), 2.57 Å

PDB Description: the crystal structure of methanol dehydrogenase from methylococcus capsulatus (bath)
PDB Compounds: (N:) Methanol dehydrogenase, small subunit

SCOPe Domain Sequences for d4tqon_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tqon_ a.137.2.1 (N:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedik

SCOPe Domain Coordinates for d4tqon_:

Click to download the PDB-style file with coordinates for d4tqon_.
(The format of our PDB-style files is described here.)

Timeline for d4tqon_: