Lineage for d1kxc__ (1kxc -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 15540Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 15566Protein Viral capsid protein [50597] (2 species)
  7. 15573Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries)
  8. 15585Domain d1kxc__: 1kxc - [26391]

Details for d1kxc__

PDB Entry: 1kxc (more details), 3.1 Å

PDB Description: sindbis virus capsid (n190k mutant), tetragonal crystal form
PDB Compounds: ( :)

SCOP Domain Sequences for d1kxc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxc__ b.47.1.3 (-) Viral capsid protein {Sindbis virus}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfykwhhgavqysggrftiprgvggrgdsgrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew

SCOP Domain Coordinates for d1kxc__:

Click to download the PDB-style file with coordinates for d1kxc__.
(The format of our PDB-style files is described here.)

Timeline for d1kxc__: