Lineage for d4tpkb_ (4tpk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (128 species)
    not a true protein
  7. 2902215Species Human (Homo sapiens) [TaxId:9606] [188340] (94 PDB entries)
  8. 2902334Domain d4tpkb_: 4tpk B: [263907]
    automated match to d1maac_
    complexed with 3f9, edo, gol, nag

Details for d4tpkb_

PDB Entry: 4tpk (more details), 2.7 Å

PDB Description: human butyrylcholinesterase in complex with n-((1-(2,3-dihydro-1h- inden-2-yl)piperidin-3-yl)methyl)-n-(2-methoxyethyl)-2-naphthamide
PDB Compounds: (B:) cholinesterase

SCOPe Domain Sequences for d4tpkb_:

Sequence, based on SEQRES records: (download)

>d4tpkb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
qnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkvl

Sequence, based on observed residues (ATOM records): (download)

>d4tpkb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
nstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkvl

SCOPe Domain Coordinates for d4tpkb_:

Click to download the PDB-style file with coordinates for d4tpkb_.
(The format of our PDB-style files is described here.)

Timeline for d4tpkb_: