SCOPe 2.05: Domain d1kxba_: 1kxb A:

Lineage for d1kxba_ (1kxb A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)

8. Domain d1kxba_: 1kxb A: [26390]
   mutant

Details for d1kxba_

PDB Entry: 1kxb, 2.9 Å

PDB Description: sindbis virus capsid (s215a mutant), tetragonal crystal form

PDB Compounds: (A:) sindbis virus capsid protein

SCOPe Domain Sequences for d1kxba_:

Sequence; same for both SEQRES and ATOM records:

>d1kxba_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdagrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew

Timeline for d1kxba_:

• d1kxba_ first appeared (with stable ids) in SCOP 1.55, called d1kxb__
  
• d1kxba_ appears in SCOPe 2.04
  
• d1kxba_ appears in SCOPe 2.06
  
• d1kxba_ appears in the current release, SCOPe 2.08